PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015900017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family ARR-B
Protein Properties Length: 666aa    MW: 72679.4 Da    PI: 5.9114
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015900017.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38e-29204257155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  XP_015900017.1 204 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 257
                     79*******************.********************************8 PP

2Response_reg73.86.5e-25261341109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl+vdD+p+ + +l+++l+   y ev+ +  +e al +l+e++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a + ++ + + +  G
  XP_015900017.1  26 VLVVDDDPTCLVILEKMLRTCLY-EVTKCNRAEIALSMLRENKngYDIVISDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDGKNVVMKGVTHG 118
                     89*********************.***************999999**********************6654.8********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +e+l++
  XP_015900017.1 119 ACDYLIKPVRIEALRN 134
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.3E-1786658IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23006.3E-4223172No hitNo description
SuperFamilySSF521721.71E-3423152IPR011006CheY-like superfamily
SMARTSM004482.5E-2924136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS501104225140IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.4E-2226134IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.08E-2627139No hitNo description
PROSITE profilePS5129411.048201260IPR017930Myb domain
SuperFamilySSF466893.58E-20201261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-30203262IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-25204257IPR006447Myb domain, plants
PfamPF002499.5E-8206256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MSTASSSAAW KAGDVVSDQF PVGLRVLVVD DDPTCLVILE KMLRTCLYEV TKCNRAEIAL  60
SMLRENKNGY DIVISDVHMP DMDGFKLLEH IGLEMDLPVI MMSADDGKNV VMKGVTHGAC  120
DYLIKPVRIE ALRNIWQHVV RKKKNERKEL EQSGSFEDGD RQAKASEDAD YSSSANEGNW  180
KSSKKRKDEE EETEDRDDTS TLKKPRVVWS VELHQQFVAA VNQLGIDKAV PKKILELMNV  240
PGLTRENVAS HLQKYRLYLR RLSGVSQHQG GLSNSFISSS ESTFGPVTSI NQMDLLNPGQ  300
FQAQNISTYQ AAGLGRSPAK SGLPMPLGDQ RNLFSFENPK LRFGEGQQQH MTSSKSMNLL  360
HGIPTAMEPK QLANLHQSAQ ALGGVNLQVN GHGAQNNNLL IQMAQQHSRG PILNEATGGH  420
VPRLPSSMGQ PIVSNGIPGG VLGRNGIADG GRGAGYNPIL QSSSLLNFPL NHTPDLPGNS  480
FPLGSTPGLS SLTSKGTFPD EVTSDIKGSA GFVPSYDIFN DLNQHKSNDW DIQNVGMTFD  540
ASQHSNSMQG SLDVSSSILV HQGFSSNQGS LQNRNQCNVS KATFSMGDGI DHGNTQNMNQ  600
HLNTLLGDNS IRVKTERVTD AGSQTTFFPE QFGPEDLMSA LLKQEDIQPS ENEFGFDGYS  660
MDNIPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-23203263464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015900017.10.0PREDICTED: two-component response regulator ARR1 isoform X2
SwissprotQ940D00.0ARR1_ARATH; Two-component response regulator ARR1
TrEMBLM5XK840.0M5XK84_PRUPE; Uncharacterized protein
STRINGGLYMA07G37220.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.20.0response regulator 1